| Bioactivity | Exendin-3 is a biologically active peptides isolated from venoms of the Gila monster lizards, Heloderma horridurn. | ||||||
| Invitro | Exendin-3 interacts with at least two receptors on guinea pig pancreatic acini; at high concentrations (>100 nM) the peptide interacts with VIP receptors, thereby causing a large increase in cAMP and stimulating amylase release; at lower concentrations (0.1-3 nM) the peptide interacts with a putative exendin receptor, thereby causing a smaller increase in cAMP of undetermined function[1]. | ||||||
| Name | Exendin-3 | ||||||
| CAS | 130357-25-4 | ||||||
| Sequence | His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 | ||||||
| Shortening | HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 | ||||||
| Formula | C184H282N50O61S | ||||||
| Molar Mass | 4202.57 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture and light, under nitrogen
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen) |
Exendin-3
CAS: 130357-25-4 F: C184H282N50O61S W: 4202.57
Exendin-3 is a biologically active peptides isolated from venoms of the Gila monster lizards, Heloderma horridurn.
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.