| Bioactivity | Exendin(9-39) amide acetate is a glucagon-like peptide-1 (GLP-1) antagonist that competes with endogenous GLP-1 for the GLP-1R, counteracting the effects of excessive GLP-1 secretion. Exendin(9-39) amide acetate can be utilized in Postbariatric hypoglycemia (PBH) research[1]. |
| CAS | 2051593-46-3 |
| Sequence | Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 |
| Shortening | DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
| Formula | C155H246N40O53S |
| Molar Mass | 3549.91 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Craig CM, et al. PREVENT: A Randomized, Placebo-controlled Crossover Trial of Avexitide for Treatment of Postbariatric Hypoglycemia. J Clin Endocrinol Metab. 2021 Jul 13;106(8):e3235-e3248. |
Exendin(9-39) amide acetate
CAS: 2051593-46-3 F: C155H246N40O53S W: 3549.91
Exendin(9-39) amide acetate is a glucagon-like peptide-1 (GLP-1) antagonist that competes with endogenous GLP-1 for the
Data collection：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.