| Bioactivity | Ergtoxin-1 is a potassium channel blocker.Ergtoxin-1 is isolated from the venom of the Mexican scorpionCentruroides noxius. Ergtoxin 1 can blockERG-K+ channels in nerve, heart and endocrine cells[1]. |
| Name | Ergtoxin-1 |
| CAS | 304436-85-9 |
| Sequence | Asp-Arg-Asp-Ser-Cys-Val-Asp-Lys-Ser-Arg-Cys-Ala-Lys-Tyr-Gly-Tyr-Tyr-Gln-Glu-Cys-Gln-Asp-Cys-Cys-Lys-Asn-Ala-Gly-His-Asn-Gly-Gly-Thr-Cys-Met-Phe-Phe-Lys-Cys-Lys-Cys-Ala (Disulfide bridge:Cys5-Cys23;Cys11-Cys34;Cys20-Cys39;Cys24-Cys41) |
| Shortening | DRDSCVDKSRCAKYGYYQECQDCCKNAGHNGGTCMFFKCKCA (Disulfide bridge:Cys5-Cys23;Cys11-Cys34;Cys20-Cys39;Cys24-Cys41) |
| Formula | C193H287N59O63S9 |
| Molar Mass | 4730.29 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Scaloni A, et al. Disulfide bridges of ergtoxin, a member of a new sub-family of peptide blockers of the ether-a-go-go-related K+ channel. FEBS Lett. 2000 Aug 18;479(3):156-7. |
Ergtoxin-1
CAS: 304436-85-9 F: C193H287N59O63S9 W: 4730.29
Ergtoxin-1 is a potassium channel blocker.Ergtoxin-1 is isolated from the venom of the Mexican scorpionCentruroides noxi
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.