PeptideDB

Eneboparatide

CAS: 1349298-00-5 F: C191H312N60O49S W: 4264.96

Eneboparatide (AZP-3601), a 36 amino-acid PTH analog, is also a parathyroid hormone receptor 1 (PTHR1) agonist. Enebopar
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Eneboparatide (AZP-3601), a 36 amino-acid PTH analog, is also a parathyroid hormone receptor 1 (PTHR1) agonist. Eneboparatide increases albumin-adjusted serum calcium values, but stayed within normal laboratory range[1].
Name Eneboparatide
CAS 1349298-00-5
Sequence Ala-Val-Ala-Glu-Ile-Gln-Leu-Met-His-Gln-Arg-Ala-Lys-Trp-Ile-Gln-Asp-Ala-Arg-Arg-Arg-Ala-Phe-Leu-His-Lys-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-Glu-Ile
Shortening AVAEIQLMHQRAKWIQDARRRAFLHKLIAEIHTAEI
Formula C191H312N60O49S
Molar Mass 4264.96
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Allas S, et al. A Single Administration of AZP-3601, a Novel, Long-Acting PTH Analog, Induces a Significant and Sustained Calcemic Response: Preliminary Data From a Randomized, Double-Blind, Placebo-Controlled Phase 1 Study. J Endocr Soc. 2021 May 3;5(Suppl 1):A254.