| Bioactivity | Elafin,also known as elafin-specific inhibitor (ESI) or skin anti-leucoprotease (SKALP), is a low molecular weight inhibitor of human neutrophil elastase (HNE) and proteinase 3 in lung. Elafin is antibiotic against Pseudomonas aeruginosa and Staphylococcus aureus[1][2][3]. |
| Name | Elafin(human) |
| Sequence | Ala-Gln-Glu-Pro-Val-Lys-Gly-Pro-Val-Ser-Thr-Lys-Pro-Gly-Ser-Cys-Pro-Ile-Ile-Leu-Ile-Arg-Cys-Ala-Met-Leu-Asn-Pro-Pro-Asn-Arg-Cys-Leu-Lys-Asp-Thr-Asp-Cys-Pro-Gly-Ile-Lys-Lys-Cys-Cys-Glu-Gly-Ser-Cys-Gly-Met-Ala-Cys-Phe-Val-Pro-Gln (Disulfide bridge:Cys16- Cys45, Cys23- Cys49, Cys32- Cys44, Cys38-Cys53) |
| Shortening | AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disulfide bridge:Cys16- Cys45, Cys23- Cys49, Cys32- Cys44, Cys38-Cys53) |
| Formula | C254H416N72O75S10 |
| Molar Mass | 5999.11 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. A J Simpson, et al. Elafin (elastase-specific inhibitor) has anti-microbial activity against Gram-positive and Gram-negative respiratory pathogens. FEBS Lett. 1999 Jun 11;452(3):309-13. [2]. Lee Shaw, et al. Therapeutic potential of human elafin. Biochem Soc Trans. 2011 Oct;39(5):1450-4. [3]. Sophie Paczesny, et al. Elafin Is a Biomarker of Graft-Versus-Host Disease of the Skin. Sci Transl Med. 2010 Jan 6;2(13):13ra2. |
Elafin(human)
CAS: F: C254H416N72O75S10 W: 5999.11
Elafin,also known as elafin-specific inhibitor (ESI) or skin anti-leucoprotease (SKALP), is a low molecular weight inhib
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.