| Bioactivity | Ecnoglutide is a glucagon-like peptide 1 (GLP-1) receptor agonist[1]. |
| Name | Ecnoglutide |
| CAS | 2459531-73-6 |
| Sequence | Chain 1：His-Val-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Arg-Glu-Phe-Ile-Lys-Trp-Leu-Val-Arg-Gly-Arg-Gly；Chain 2：Ggu-Oaa-Oaa (Amide bridge:Lys24-Oaa2) |
| Shortening | Chain 1：HVEGTFTSDVSSYLEEQAAREFIKWLVRGRG；Chain 2：Ggu-Oaa-Oaa (Amide bridge:Lys24-Oaa2) |
| Formula | C₁₉₄H₃₀₄N₄₈O₆₁ |
| Molar Mass | 4284.76 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |