| Bioactivity | Echistatin TFA, the smallest active RGD protein belonging to the family of disintegrins that are derived from snake venoms, is a potent inhibitor of platelet aggregation. Echistatin is a potent inhibitor of bone resorption in culture. Echistatin is a potent antagonist of αIIbβ3, αvβ3 and α5β1[1][2][3][4]. | ||||||
| Name | Echistatin TFA | ||||||
| Shortening | ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT (Disulfide bridge:Cys2-Cys11;Cys7-Cys32;Cys8-Cys37;Cys20-Cys39) | ||||||
| Formula | C219H342F3N71O76S9 | ||||||
| Molar Mass | 5531.02 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
Echistatin TFA
CAS: F: C219H342F3N71O76S9 W: 5531.02
Echistatin TFA, the smallest active RGD protein belonging to the family of disintegrins that are derived from snake veno
Data collection：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.