| Bioactivity | ELA RR>GG (ELA-32 negative control), an ELABELA (ELA-32 human) mutant peptide, is inactive. ELA RR>GG is a negative control for ELABELA (HY-P2196)[1]. |
| Name | ELA RR>GG |
| Sequence | Gln-Arg-Pro-Val-Asn-Leu-Thr-Met-Gly-Gly-Lys-Leu-Arg-Lys-His-Asn-Cys-Leu-Gln-Arg-Arg-Cys-Met-Pro-Leu-His-Ser-Arg-Val-Pro-Phe-Pro (Disulfide bridge: Cys17-Cys22) |
| Shortening | QRPVNLTMGGKLRKHNCLQRRCMPLHSRVPFP (Disulfide bridge: Cys17-Cys22) |
| Formula | C162H271N57O39S4 |
| Molar Mass | 3769.55 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |