| Bioactivity | Des His1, Glu8 Exendin-4 is a potent glucagon-like peptide-1 receptor (GLP-1-R) antagonist. Des His1, Glu8 Exendin-4 improves glucose homeostasis by regulating both insulin secretion and glucose production. Des His1, Glu8 Exendin-4 can be used for the research of type 2 diabetic and gastrointestinal[1]. |
| Name | Des His1, Glu8 Exendin-4 |
| Shortening | GEGTFTSELSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
| Formula | C179H277N47O59S |
| Molar Mass | 4063.46 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Des His1, Glu8 Exendin-4
CAS: F: C179H277N47O59S W: 4063.46
Des His1, Glu8 Exendin-4 is a potent glucagon-like peptide-1 receptor (GLP-1-R) antagonist. Des His1, Glu8 Exendin-4 imp
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.