PeptideDB

Des His1, Glu8 Exendin-4

CAS: F: C179H277N47O59S W: 4063.46

Des His1, Glu8 Exendin-4 is a potent glucagon-like peptide-1 receptor (GLP-1-R) antagonist. Des His1, Glu8 Exendin-4 imp
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Des His1, Glu8 Exendin-4 is a potent glucagon-like peptide-1 receptor (GLP-1-R) antagonist. Des His1, Glu8 Exendin-4 improves glucose homeostasis by regulating both insulin secretion and glucose production. Des His1, Glu8 Exendin-4 can be used for the research of type 2 diabetic and gastrointestinal[1].
Name Des His1, Glu8 Exendin-4
Shortening GEGTFTSELSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Formula C179H277N47O59S
Molar Mass 4063.46
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.