PeptideDB

Dendrotoxin K

CAS: 119128-61-9 F: C294H462N84O75S6 W: 6559.66

Dendrotoxin K is a Kv1.1 channel blocker. Dendrotoxin K determines glutamate release in CA3 neurons in a time-dependent
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Dendrotoxin K is a Kv1.1 channel blocker. Dendrotoxin K determines glutamate release in CA3 neurons in a time-dependent manner through the control of the presynaptic spike waveform[1].
Name Dendrotoxin K
CAS 119128-61-9
Sequence Ala-Ala-Lys-Tyr-Cys-Lys-Leu-Pro-Leu-Arg-Ile-Gly-Pro-Cys-Lys-Arg-Lys-Ile-Pro-Ser-Phe-Tyr-Tyr-Lys-Trp-Lys-Ala-Lys-Gln-Cys-Leu-Pro-Phe-Asp-Tyr-Ser-Gly-Cys-Gly-Gly-Asn-Ala-Asn-Arg-Phe-Lys-Thr-Ile-Glu-Glu-Cys-Arg-Arg-Thr-Cys-Val-Gly (Disulfide bridge:Cys5-Cys55,Cys14-Cys38,Cys30-Cys51)
Shortening AAKYCKLPLRIGPCKRKIPSFYYKWKAKQCLPFDYSGCGGNANRFKTIEECRRTCVG (Disulfide bridge:Cys5-Cys55,Cys14-Cys38,Cys30-Cys51)
Formula C294H462N84O75S6
Molar Mass 6559.66
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Bialowas A, et al. Analog modulation of spike-evoked transmission in CA3 circuits is determined by axonal Kv1.1 channels in a time-dependent manner. Eur J Neurosci. 2015 Feb;41(3):293-304.