PeptideDB

Dendrotoxin-I

CAS: 107950-33-4 F: C312H491N99O83S6 W: 7149.24

Dendrotoxin-I is a potent K+ channels blocker and targets voltage-gated potassium channel subunits KV1.1 and KV1.2. Dend
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Dendrotoxin-I is a potent K+ channels blocker and targets voltage-gated potassium channel subunits KV1.1 and KV1.2. Dendrotoxin-I is a neurotoxin isolated from thevenom of Dendroaspis snakes[1][2][3].
In Vivo Dendrotoxin-I (5 mg/kg; IV) displays a significant tumor growth inhibition effect combined with hyperthermia[3]. Animal Model:
Name Dendrotoxin-I
CAS 107950-33-4
Sequence Gln-Pro-Leu-Arg-Lys-Leu-Cys-Ile-Leu-His-Arg-Asn-Pro-Gly-Arg-Cys-Tyr-Gln-Lys-Ile-Pro-Ala-Phe-Tyr-Tyr-Asn-Gln-Lys-Lys-Lys-Gln-Cys-Glu-Gly-Phe-Thr-Trp-Ser-Gly-Cys-Gly-Gly-Asn-Ser-Asn-Arg-Phe-Lys-Thr-Ile-Glu-Glu-Cys-Arg-Arg-Thr-Cys-Ile-Arg-Lys (Disulfide bridge:Cys7-Cys57;Cys16-Cys40;Cys32-Cys53)
Shortening QPLRKLCILHRNPGRCYQKIPAFYYNQKKKQCEGFTWSGCGGNSNRFKTIEECRRTCIRK (Disulfide bridge:Cys7-Cys57;Cys16-Cys40;Cys32-Cys53)
Formula C312H491N99O83S6
Molar Mass 7149.24
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. H Rehm, et al. Purification and subunit structure of a putative K+-channel protein identified by its binding properties for dendrotoxin I. Proc Natl Acad Sci U S A. 1988 Jul;85(13):4919-23. [2]. Tess Wright, et al. Firing frequency and entrainment maintained in primary auditory neurons in the presence of combined BDNF and NT3. Sci Rep. 2016 Jun 23;6:28584. [3]. Hui Zhang, et al. Preparation, characterization, and pharmacodynamics of thermosensitive liposomes containing docetaxel. J Pharm Sci. 2014 Jul;103(7):2177-2183.