| Bioactivity | Dendroaspis Natriuretic Peptide is a vasodilator peptide that can be isolated from animal venom[1]. |
| Name | Dendroaspis Natriuretic Peptide |
| CAS | 255721-52-9 |
| Sequence | Glu-Val-Lys-Tyr-Asp-Pro-Cys-Phe-Gly-His-Lys-Ile-Asp-Arg-Ile-Asn-His-Val-Ser-Asn-Leu-Gly-Cys-Pro-Ser-Leu-Arg-Asp-Pro-Arg-Pro-Asn-Ala-Pro-Ser-Thr-Ser-Ala (Disulfide bridge: Cys7-Cys23) |
| Shortening | EVKYDPCFGHKIDRINHVSNLGCPSLRDPRPNAPSTSA (Disulfide bridge: Cys7-Cys23) |
| Formula | C180H282N56O56S2 |
| Molar Mass | 4190.64 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Alves RS, et al. Isolation, homology modeling and renal effects of a C-type natriuretic peptide from the venom of the Brazilian yellow scorpion (Tityus serrulatus). Toxicon. 2013 Nov;74:19-26. |
Dendroaspis Natriuretic Peptide
CAS: 255721-52-9 F: C180H282N56O56S2 W: 4190.64
Dendroaspis Natriuretic Peptide is a vasodilator peptide that can be isolated from animal venom.
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.