| Bioactivity | Defensin HNP-3 human is a cytotoxic antibiotic peptide known as "defensin". Defensin HNP-3 human has inhibitory activity against Staphylococcus aureus, Pseudomonas aeruginosa and Escherichia coli. Defensin HNP-3 human is initially synthesized as the 94 amino acids preproHNP(1-94), which is hydrolyzed to proHNP(20-94) and converted to mature HNP(65-94) after the removal of anion precursors[1][2]. |
| Name | Defensin HNP-3 human |
| CAS | 136661-76-2 |
| Sequence | Asp-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys (Disulfide bridge:Cys2-Cys30,Cys4-Cys19,Cys9-Cys29) |
| Shortening | DCYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge:Cys2-Cys30,Cys4-Cys19,Cys9-Cys29) |
| Formula | C151H222N44O40S6 |
| Molar Mass | 3486.04 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Valore EV, et al. Intramolecular inhibition of human defensin HNP-1 by its propiece. J Clin Invest. 1996 Apr 1;97(7):1624-9. [2]. Ganz T, et al. Defensins. Natural peptide antibiotics of human neutrophils[J]. The Journal of clinical investigation, 1985, 76(4): 1427-1435. |