| Bioactivity | Defensin HNP-1 human is a Human neutrophil peptides (HNPs), involved in endothelial cell dysfunction at the time of early atherosclerotic development. Defensin HNP-1 human exhibits broad antimicrobial and anti-leishmanial activities[1][2]. |
| Name | Defensin HNP-1 human |
| CAS | 99287-08-8 |
| Sequence | Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys |
| Shortening | ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
| Formula | C150H228N44O38S6 |
| Molar Mass | 3442.03 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Defensin HNP-1 human
CAS: 99287-08-8 F: C150H228N44O38S6 W: 3442.03
Defensin HNP-1 human is a Human neutrophil peptides (HNPs), involved in endothelial cell dysfunction at the time of earl
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.