PeptideDB

Deamino-pterinotoxin-1

CAS: F: C163H250N48O54S7 W: 3970.47

Deamino-pterinotoxin-1 is a peptide toxin synthesized from the deamination of pterinotoxin-1 (HY-5943).
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Deamino-pterinotoxin-1 is a peptide toxin synthesized from the deamination of pterinotoxin-1 (HY-5943)[1].
Target others
Name Deamino-pterinotoxin-1
Sequence Asp-Asp-Cys-Leu-Gly-Met-Phe-Ser-Ser-Cys-Asp-Pro-Asp-Asn-Asp-Lys-Cys-Cys-Glu-Gly-Arg-Lys-Cys-Asn-Arg-Lys-Asp-Lys-Trp-Cys-Lys-Tyr-Val-Leu (Disulfide bridge: Cys3-Cys18, Cys10-Cys23 and Cys17-Cys30)
Shortening DDCLGMFSSCDPDNDKCCEGRKCNRKDKWCKYVL (Disulfide bridge: Cys3-Cys18, Cys10-Cys23 and Cys17-Cys30)
Formula C163H250N48O54S7
Molar Mass 3970.47
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Xuanmao Chen, et al. The Tarantula Toxin Psalmotoxin 1 Inhibits Acid-sensing Ion Channel (ASIC) 1a by Increasing Its Apparent H+ Affinity. J Gen Physiol.2005 Jul;126(1):71-9.