| Bioactivity | Deamino-pterinotoxin-1 is a peptide toxin synthesized from the deamination of pterinotoxin-1 (HY-5943)[1]. |
| Target | others |
| Name | Deamino-pterinotoxin-1 |
| Sequence | Asp-Asp-Cys-Leu-Gly-Met-Phe-Ser-Ser-Cys-Asp-Pro-Asp-Asn-Asp-Lys-Cys-Cys-Glu-Gly-Arg-Lys-Cys-Asn-Arg-Lys-Asp-Lys-Trp-Cys-Lys-Tyr-Val-Leu (Disulfide bridge: Cys3-Cys18, Cys10-Cys23 and Cys17-Cys30) |
| Shortening | DDCLGMFSSCDPDNDKCCEGRKCNRKDKWCKYVL (Disulfide bridge: Cys3-Cys18, Cys10-Cys23 and Cys17-Cys30) |
| Formula | C163H250N48O54S7 |
| Molar Mass | 3970.47 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Xuanmao Chen, et al. The Tarantula Toxin Psalmotoxin 1 Inhibits Acid-sensing Ion Channel (ASIC) 1a by Increasing Its Apparent H+ Affinity. J Gen Physiol.2005 Jul;126(1):71-9. |