| Bioactivity | DN59 is a 33 amino acid peptide that mimics the dengue virus type 2 E stem region. DN59 inhibits all four serotypes of dengue virus (IC50: 2-5 μM) as well as other flaviviruses. N59 causes the release of genomic RNA by interacting directly with viral particles. DN59 has antiviral activity[1]. |
| CAS | 869011-94-9 |
| Sequence | Met-Ala-Ile-Leu-Gly-Asp-Thr-Ala-Trp-Asp-Phe-Gly-Ser-Leu-Gly-Gly-Val-Phe-Thr-Ser-Ile-Gly-Lys-Ala-Leu-His-Gln-Val-Phe-Gly-Ala-Ile-Tyr |
| Shortening | MAILGDTAWDFGSLGGVFTSIGKALHQVFGAIY |
| Formula | C161H240N38O44S |
| Molar Mass | 3443.92 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Lok SM, et al. Release of dengue virus genome induced by a peptide inhibitor. PLoS One. 2012;7(11):e50995. |
DN59
CAS: 869011-94-9 F: C161H240N38O44S W: 3443.92
DN59 is a 33 amino acid peptide that mimics the dengue virus type 2 E stem region. DN59 inhibits all four serotypes of d
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.