| Bioactivity | Cys-LL37 is a biomaterial with antimicrobial properties developed by covalently fixing to the surface of titanium. Cys-LL37 uses a flexible hydrophilic polyethylene glycol spacer and selective n-terminal coupling LL37, a surface peptide layer that kills bacteria on contact is formed. Cys-LL37 can be used in research to develop new antimicrobial biomaterials[1]. |
| Sequence | Cys-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser |
| Shortening | CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Formula | C208H345N61O54S |
| Molar Mass | 4596.41 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Gabriel M, et al. Preparation of LL-37-grafted titanium surfaces with bactericidal activity[J]. Bioconjugate chemistry, 2006, 17(2): 548-550. |