PeptideDB

Cys-LL37

CAS: F: C208H345N61O54S W: 4596.41

Cys-LL37 is a biomaterial with antimicrobial properties developed by covalently fixing to the surface of titanium. Cys-L
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Cys-LL37 is a biomaterial with antimicrobial properties developed by covalently fixing to the surface of titanium. Cys-LL37 uses a flexible hydrophilic polyethylene glycol spacer and selective n-terminal coupling LL37, a surface peptide layer that kills bacteria on contact is formed. Cys-LL37 can be used in research to develop new antimicrobial biomaterials[1].
Sequence Cys-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser
Shortening CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Formula C208H345N61O54S
Molar Mass 4596.41
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Gabriel M, et al. Preparation of LL-37-grafted titanium surfaces with bactericidal activity[J]. Bioconjugate chemistry, 2006, 17(2): 548-550.