PeptideDB

Crotamine

CAS: F: C214H326N64O54S7 W: 4883.73

Crotamine is a Na+ channel modulator. Crotamine is a 42 amino acid toxin cross-linked by three disulfide bridges. Crotam
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Crotamine is a Na+ channel modulator. Crotamine is a 42 amino acid toxin cross-linked by three disulfide bridges. Crotamine has analgesic activity. Crotamine also interacts with lipid membranes and shows myonecrotic activity. Crotamine can be isolated from Crotalus durissus terrificus venom[1][2].
Name Crotamine
Sequence Tyr-Lys-Gln-Cys-His-Lys-Lys-Gly-Gly-His-Cys-Phe-Pro-Lys-Glu-Lys-Ile-Cys-Leu-Pro-Pro-Ser-Ser-Asp-Phe-Gly-Lys-Met-Asp-Cys-Arg-Trp-Arg-Trp-Lys-Cys-Cys-Lys-Lys-Gly-Ser-Gly (Disulfide bonds:Cys4-Cys36, Cys11-Cys30, Cys18-Cys37)
Shortening YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG (Disulfide bonds:Cys4-Cys36, Cys11-Cys30, Cys18-Cys37)
Formula C214H326N64O54S7
Molar Mass 4883.73
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Nicastro G, et al. Solution structure of crotamine, a Na+ channel affecting toxin from Crotalus durissus terrificus venom. Eur J Biochem. 2003 May;270(9):1969-79. [2]. Kerkis I, et al. Biological versatility of crotamine--a cationic peptide from the venom of a South American rattlesnake. Expert Opin Investig Drugs. 2010 Dec;19(12):1515-25.