| Bioactivity | Crotamine TFA is a Na+ channel modulator. Crotamine is a 42 amino acid toxin cross-linked by three disulfide bridges. Crotamine has analgesic activity. Crotamine also interacts with lipid membranes and shows myonecrotic activity. Crotamine can be isolated from Crotalus durissus terrificus venom[1][2]. | ||||||
| Sequence | Tyr-Lys-Gln-Cys-His-Lys-Lys-Gly-Gly-His-Cys-Phe-Pro-Lys-Glu-Lys-Ile-Cys-Leu-Pro-Pro-Ser-Ser-Asp-Phe-Gly-Lys-Met-Asp-Cys-Arg-Trp-Arg-Trp-Lys-Cys-Cys-Lys-Lys-Gly-Ser-Gly (Disulfide bonds：Cys4-Cys36, Cys11-Cys30, Cys18-Cys37) | ||||||
| Shortening | YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG (Disulfide bonds：Cys4-Cys36, Cys11-Cys30, Cys18-Cys37) | ||||||
| Formula | C214H326N64O54S7.xC2HF3O2 | ||||||
| Molar Mass | 4883.73 (free base) | ||||||
| Appearance | 固体 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
||||||
| Reference | [1]. Nicastro G, et al. Solution structure of crotamine, a Na+ channel affecting toxin from Crotalus durissus terrificus venom. Eur J Biochem. 2003 May;270(9):1969-79. [2]. Kerkis I, et al. Biological versatility of crotamine--a cationic peptide from the venom of a South American rattlesnake. Expert Opin Investig Drugs. 2010 Dec;19(12):1515-25. |