PeptideDB

Corza6

CAS: F: C203H293N55O61S7 W: 4704.29

Corza6 is a potent and selective human voltage-gated proton channel (hHv1) peptide inhibitor. Corza6 binds to the extern
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Corza6 is a potent and selective human voltage-gated proton channel (hHv1) peptide inhibitor. Corza6 binds to the external voltage sensor domain (VSD) loop in hHv1 with a Kd of ~1 nM at the natural, hyperpolarized resting membrane potential (RMP) of mammalian cells. Corza6 allows capacitation in sperm and permits sustained reactive oxygen species (ROS) production in white blood cells (WBCs)[1].
Sequence Ser-Ser-Thr-Cys-Ile-Pro-Ser-Gly-Gln-Pro-Cys-Ala-Asp-Ser-Asp-Asp-Cys-Cys-Glu-Thr-Phe-His-Cys-Lys-Trp-Val-Phe-Phe-Thr-Ser-Lys-Phe-Met-Cys-Arg-Arg-Val-Trp-Gly-Lys-Asp (Disulfide bridge:Cys4-Cys18;Cys11-Cys23;Cys17-Cys34)
Shortening SSTCIPSGQPCADSDDCCETFHCKWVFFTSKFMCRRVWGKD (Disulfide bridge:Cys4-Cys18;Cys11-Cys23;Cys17-Cys34)
Formula C203H293N55O61S7
Molar Mass 4704.29
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Ruiming Zhao, et al. Role of human Hv1 channels in sperm capacitation and white blood cell respiratory burst established by a designed peptide inhibitor. Proc Natl Acad Sci U S A. 2018 Dec 11;115(50):E11847-E11856.