| Bioactivity | Copeptin (human) is a diagnostic and prognostic biomarker for cardiovascular disease (CVD). Copeptin (human) is also the carboxyl terminus of the arginine vasopressin (AVP) precursor peptide. Copeptin (human) can be used in the study of cardiovascular disease[1]. |
| Name | Copeptin (human) |
| CAS | 78362-34-2 |
| Sequence | Ala-Ser-Asp-Arg-Ser-Asn-Ala-Thr-Gln-Leu-Asp-Gly-Pro-Ala-Gly-Ala-Leu-Leu-Leu-Arg-Leu-Val-Gln-Leu-Ala-Gly-Ala-Pro-Glu-Pro-Phe-Glu-Pro-Ala-Gln-Pro-Asp-Ala-Tyr |
| Shortening | ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY |
| Formula | C177H279N49O58 |
| Molar Mass | 4021.40 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Mu D, et al. Copeptin as a Diagnostic and Prognostic Biomarker in Cardiovascular Diseases. Front Cardiovasc Med. 2022 Jul 4;9:901990. |
Copeptin (human)
CAS: 78362-34-2 F: C177H279N49O58 W: 4021.40
Copeptin (human) is a diagnostic and prognostic biomarker for cardiovascular disease (CVD). Copeptin (human) is also the
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.