| Bioactivity | Cn2 toxin TFA (β-Mammal toxin Cn2 TFA) is a single-chain β-scorpion neurotoxic peptide that is the main toxin in scorpion venom. Cn2 toxin (TFA) specifically targets mammalian voltage-gated sodium channels (VGSC) Nav1.6[1]. |
| Name | Cn2 toxin TFA |
| Sequence | Lys-Glu-Gly-Tyr-Leu-Val-Asp-Lys-Asn-Thr-Gly-Cys-Lys-Tyr-Glu-Cys-Leu-Lys-Leu-Gly-Asp-Asn-Asp-Tyr-Cys-Leu-Arg-Glu-Cys-Lys-Gln-Gln-Tyr-Gly-Lys-Gly-Ala-Gly-Gly-Tyr-Cys-Tyr-Ala-Phe-Ala-Cys-Trp-Cys-Thr-His-Leu-Tyr-Glu-Gln-Ala-Ile-Val-Trp-Pro-Leu-Pro-Asn-Lys-Arg-Cys-Ser-NH2 (Disulfide bridge:Cys12-Cys65;Cys16-Cys41;Cys25-Cys46;Cys29-Cys48) |
| Shortening | KEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGGYCYAFACWCTHLYEQAIVWPLPNKRCS-NH2 (Disulfide bridge:Cys12-Cys65;Cys16-Cys41;Cys25-Cys46;Cys29-Cys48) |
| Formula | C336H496N90O96S8.xC2HF3O2 |
| Molar Mass | 7588.60 (free base) |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Chen R, et al. Conserved functional surface of antimammalian scorpion β-toxins. J Phys Chem B. 2012 Apr 26;116(16):4796-800. |
Cn2 toxin TFA
CAS: F: C336H496N90O96S8.xC2HF3O2 W: 7588.60 (free base)
Cn2 toxin TFA (β-Mammal toxin Cn2 TFA) is a single-chain β-scorpion neurotoxic peptide that is the main toxin in scorp
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.