Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R)_product_DataBase

CAS: 1678417-57-6 F: C201H334N82O55S2 W: 4843.45

Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R), a chimeric peptide consisting of 29 amino acids, is synthesized by

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity	Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R), a chimeric peptide consisting of 29 amino acids, is synthesized by adding nona-arginine motif to the carboxy terminus of RVG (rabies virus glycoprotein). Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R) is positively charged and able to bind negatively charged nucleic acids via charge interaction[1][2].
Name	Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R)
CAS	1678417-57-6
Sequence	Tyr-Thr-Ile-Trp-Met-Pro-Glu-Asn-Pro-Arg-Pro-Gly-Thr-Pro-Cys-Asp-Ile-Phe-Thr-Asn-Ser-Arg-Gly-Lys-Arg-Ala-Ser-Asn-Gly-Gly-Gly-Gly-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg
Shortening	YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR
Formula	C201H334N82O55S2
Molar Mass	4843.45
Transport	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.

PeptideDB