| Bioactivity | Charybdotoxin, a 37-amino acid peptide, is a K+ channel blocker[1]. |
| Invitro | Charybdotoxin represents a remarkable tool for studying K+ channels[1]. |
| Name | Charybdotoxin |
| CAS | 95751-30-7 |
| Sequence | {Glp}-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser (Disulfide bridge: Cys7-Cys28; Cys13-Cys33; Cys17-Cys35) |
| Shortening | {Glp}-FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (Disulfide bridge: Cys7-Cys28; Cys13-Cys33; Cys17-Cys35) |
| Formula | C176H277N57O55S7 |
| Molar Mass | 4295.89 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |