| Bioactivity | Charybdotoxin TFA, a 37-amino acid peptide, is a K+ channel blocker[1]. | ||||||
| Invitro | Charybdotoxin represents a remarkable tool for studying K+ channels[1]. | ||||||
| Name | Charybdotoxin TFA | ||||||
| Sequence | {Glp}-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser (Disulfide bridge: Cys7-Cys28; Cys13-Cys33; Cys17-Cys35) | ||||||
| Shortening | {Glp}-FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (Disulfide bridge: Cys7-Cys28; Cys13-Cys33; Cys17-Cys35) | ||||||
| Formula | C176H277N57O55S7.C2HF3O2 | ||||||
| Molar Mass | 4409.91 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture and light
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light) |