PeptideDB

Ceratotoxin-1

CAS: F: C172H256N52O50S6 W: 4044.58

Ceratotoxin-1 (CcoTx1), a peptide toxin, is an voltage-gated sodium channel subtypes inhibitor. Ceratotoxin-1 inhibits N
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Ceratotoxin-1 (CcoTx1), a peptide toxin, is an voltage-gated sodium channel subtypes inhibitor. Ceratotoxin-1 inhibits Nav1.1/β1, Nav1.2/β1, Nav1.4/β1, and Nav1.5/β1 with IC50 of 523 nM, 3 nM, 888 nM, and 323 nM, respectively. Ceratotoxin-1 also inhibits Nav1.8/β1[1].
Name Ceratotoxin-1
Sequence Asp-Cys-Leu-Gly-Trp-Phe-Lys-Ser-Cys-Asp-Pro-Lys-Asn-Asp-Lys-Cys-Cys-Lys-Asn-Tyr-Thr-Cys-Ser-Arg-Arg-Asp-Arg-Trp-Cys-Lys-Tyr-Asp-Leu-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys22;Cys16-Cys29)
Shortening DCLGWFKSCDPKNDKCCKNYTCSRRDRWCKYDL-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys22;Cys16-Cys29)
Formula C172H256N52O50S6
Molar Mass 4044.58
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Frank Bosmans, et al. Four novel tarantula toxins as selective modulators of voltage-gated sodium channel subtypes. Mol Pharmacol. 2006 Feb;69(2):419-29.