| Bioactivity | Cecropin D is an antimicrobial peptide with a MIC of 4.55 μg/mL. Cecropin D is effective against both Gram-negative and Gram-positive bacteria. Cecropin D has antiviral, antifungal, antitumor, and immunomodulatory[1][2]. |
| Name | Cecropin D |
| CAS | 83652-32-8 |
| Sequence | Trp-Asn-Pro-Phe-Lys-Glu-Leu-Glu-Lys-Val-Gly-Gln-Arg-Val-Arg-Asp-Ala-Val-Ile-Ser-Ala-Gly-Pro-Ala-Val-Ala-Thr-Val-Ala-Gln-Ala-Thr-Ala-Leu-Ala-Lys-Asn-His-NH2 |
| Shortening | WNPFKELEKVGQRVRDAVISAGPAVATVAQATALAK-NH2 |
| Formula | C180H293N55O51 |
| Molar Mass | 4043.59 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Cecropin D
CAS: 83652-32-8 F: C180H293N55O51 W: 4043.59
Cecropin D is an antimicrobial peptide with a MIC of 4.55 μg/mL. Cecropin D is effective against both Gram-negative and
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.