PeptideDB

Cecropin B

CAS: 80451-05-4 F: C176H302N52O41S W: 3834.67

Cecropin B has high level of antimicrobial activity and is considered as a valuable peptide antibiotic.
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Cecropin B has high level of antimicrobial activity and is considered as a valuable peptide antibiotic.
Invitro Cecropin B-induces NF-κB activation playing a pivotal role in the suppression of CYP3A29 through disrupting the association of the PXR/retinoid X receptor alpha (RXR-α) complex with DNA sequences. Cecropin B activates pig liver cells by interacting with TLRs 2 and 4, which modulated NF-κB-mediated signaling pathways[1].
Name Cecropin B
CAS 80451-05-4
Sequence Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2
Shortening KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2
Formula C176H302N52O41S
Molar Mass 3834.67
Transport Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)