| Bioactivity | Cecropin B has high level of antimicrobial activity and is considered as a valuable peptide antibiotic. | ||||||
| Invitro | Cecropin B-induces NF-κB activation playing a pivotal role in the suppression of CYP3A29 through disrupting the association of the PXR/retinoid X receptor alpha (RXR-α) complex with DNA sequences. Cecropin B activates pig liver cells by interacting with TLRs 2 and 4, which modulated NF-κB-mediated signaling pathways[1]. | ||||||
| Name | Cecropin B | ||||||
| CAS | 80451-05-4 | ||||||
| Sequence | Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2 | ||||||
| Shortening | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2 | ||||||
| Formula | C176H302N52O41S | ||||||
| Molar Mass | 3834.67 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |