Cecropin B free acid_product_DataBase

CAS: 203265-23-0 F: C176H301N51O42S W: 3835.65

Cecropin B (free acid), is a polypeptide that can be found by peptide screening. Peptide screening is a research tool th

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity	Cecropin B (free acid), is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of drug research and development[1].
Name	Cecropin B free acid
CAS	203265-23-0
Sequence	Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu
Shortening	KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL
Formula	C176H301N51O42S
Molar Mass	3835.65
Transport	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Reference	[1]. Birnbaum S, et al. Peptide screening. Current Opinion in Biotechnology, 1992, 3(1): 49-54.

PeptideDB