| Bioactivity | Candidalysin is a cytolytic peptide toxin, which is initially isolated from Candida albicans and exhibits virulent and avirulent characters. Candidalysin activates epithelial cell signaling pathways by interacting with the epithelial growth factor receptor (EGFR) of host cells, activates matrix metalloproteinase (MMP) and calcium flux, resulting in inflammatory responses and recruitment of immune cells. Candidalysin exhibits cytotoxicity by dealing membran damage to host cells[1]. |
| CAS | 1906866-53-2 |
| Sequence | Ser-Ile-Ile-Gly-Ile-Ile-Met-Gly-Ile-Leu-Gly-Asn-Ile-Pro-Gln-Val-Ile-Gln-Ile-Ile-Met-Ser-Ile-Val-Lys-Ala-Phe-Lys-Gly-Asn-Lys |
| Shortening | SIIGIIMGILGNIPQVIQIIMSIVKAFKGNK |
| Formula | C153H266N38O38S2 |
| Molar Mass | 3310.11 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Naglik JR, et al., Candidalysin: discovery and function in Candida albicans infections. Curr Opin Microbiol. 2019 Dec;52:100-109. |
Candidalysin
CAS: 1906866-53-2 F: C153H266N38O38S2 W: 3310.11
Candidalysin is a cytolytic peptide toxin, which is initially isolated from Candida albicans and exhibits virulent and a
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.