| Bioactivity | Calcitonin salmon, a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption. | ||||||
| Name | Calcitonin (salmon) | ||||||
| CAS | 47931-85-1 | ||||||
| Sequence | Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bridge: Cys1-Cys7) | ||||||
| Shortening | CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: Cys1-Cys7) | ||||||
| Formula | C145H240N44O48S2 | ||||||
| Molar Mass | 3431.85 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
Calcitonin (salmon)
CAS: 47931-85-1 F: C145H240N44O48S2 W: 3431.85
Calcitonin salmon, a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulat
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.