| Bioactivity | Calcitonin (salmon) (acetate) is a dual-action amylin and calcitonin receptor agonist, can stimulate bone formation and inhibit bone resorption[1].The acetate form can affect the absorption and efficacy of hormones[2]. |
| CAS | 158000-61-4 |
| Sequence | Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bridge: Cys1-Cys7) |
| Shortening | CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: Cys1-Cys7) |
| Formula | C145H240N44O48S2.xC2H4O2 |
| Molar Mass | 3431.85 (free base) |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Feigh M, et al. Oral salmon calcitonin attenuates hyperglycaemia and preserves pancreatic beta-cell area and function in Zucker diabetic fatty rats. Br J Pharmacol. 2012 Sep;167(1):151-63. [2]. |