PeptideDB

Calcitonin (chicken)

CAS: 100016-62-4 F: C145H240N42O46S2 W: 3371.84

Calcitonin chicken is a hormone, that regulates calcium metabolism. Calcitonin chicken suppresses the cell motility and
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Calcitonin chicken is a hormone, that regulates calcium metabolism. Calcitonin chicken suppresses the cell motility and bone resorption in neonatal rat osteoclasts[1].
CAS 100016-62-4
Sequence Cys-Ala-Ser-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH2 (Disulfide bridge: Cys1-Cys7)
Shortening CASLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 (Disulfide bridge: Cys1-Cys7)
Formula C145H240N42O46S2
Molar Mass 3371.84
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Dempster DW, et al., Biological activity of chicken calcitonin: effects on neonatal rat and embryonic chick osteoclasts. J Bone Miner Res. 1987 Oct;2(5):443-8.