| Bioactivity | Calcicludine is a protein toxin from the venom of the green mamba Dendroaspis angusticeps that inhibits high-voltage-activated calcium channel, especially L-type calcium channel with the IC50 of 88 nM. Calcicludine has role in excitatory synaptic transmission[1][2]. |
| Name | Calcicludine |
| CAS | 178036-64-1 |
| Sequence | Trp-Gln-Pro-Pro-Trp-Tyr-Cys-Lys-Glu-Pro-Val-Arg-Ile-Gly-Ser-Cys-Lys-Lys-Gln-Phe-Ser-Ser-Phe-Tyr-Phe-Lys-Trp-Thr-Ala-Lys-Lys-Cys-Leu-Pro-Phe-Leu-Phe-Ser-Gly-Cys-Gly-Gly-Asn-Ala-Asn-Arg-Phe-Gln-Thr-Ile-Gly-Glu-Cys-Arg-Lys-Lys-Cys-Leu-Gly-Lys (Disulfide bridge: Cys7-Cys57; Cys16-Cys40; Cys32-Cys53) |
| Shortening | WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK (Disulfide bridge: Cys7-Cys57; Cys16-Cys40; Cys32-Cys53) |
| Formula | C321H476N86O78S6 |
| Molar Mass | 6980.13 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. H Schweitz, et al. Calcicludine, a venom peptide of the Kunitz-type protease inhibitor family, is a potent blocker of high-threshold Ca2+ channels with a high affinity for L-type channels in cerebellar granule neurons. Proc Natl Acad Sci U S A. 1994 Feb 1;91(3):878-82. [2]. S C Stotz, et al. Block of Voltage-dependent Calcium Channel by the Green Mamba Toxin Calcicludine. J Membr Biol. 2000 Mar 15;174(2):157-65. |