PeptideDB

Cagrilintide acetate

CAS: F: C196H316N54O61S2 W: 4469.06

Cagrilintide acetate is a non-selective AMYR/CTR agonist and long-acting acylated amylase analogue. Cagrilintide acetate
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Cagrilintide acetate is a non-selective AMYR/CTR agonist and long-acting acylated amylase analogue. Cagrilintide acetate causes a reduction in food intake and significant weight loss in a dose-dependent manner. Cagrilintide acetate can be used in obesity studies[1][2][3].
Name Cagrilintide acetate
Sequence {Eicosanedioic acid-γ-Glu}-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Glu-Phe-Leu-Arg-His-Ser-Ser-NH2 (Disulfide bridge:Cys3-Cys8)
Shortening {Eicosanedioic acid-g-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Disulfide bridge:Cys3-Cys8)
Formula C196H316N54O61S2
Molar Mass 4469.06
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.