| Bioactivity | CTCE-0214 is a chemokine CXC receptor 4 (CXCR4) agonist, SDF-1α (stromal cell-derived factor-1α) peptide analog. CTCE-0214 shows anti-inflammatory activity, and can be used in inflammation sepsis and systemic inflammatory syndromes research[1][2][3]. |
| Invitro | CTCE-0214 (0.01-0.1 ng/mL; 4 d) increases the expansion of CD34+ cells subsets[3]. |
| Name | CTCE-0214 |
| CAS | 577782-52-6 |
| Shortening | KPVSLSYRAPFRFFGGGGLKWIQEYLEKALN-NH2 (Lactam:Lys20-Glu24) |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |