| Bioactivity | CRSP-1 is short for calcitonin receptor-stimulating peptide-1. CRSP-1 inhibits osteoclast formation by inhibiting the formation and activity of multinucleated osteoclast[1]. |
| CAS | 697327-12-1 |
| Sequence | Ser-Cys-Asn-Thr-Ala-Thr-Cys-Met-Thr-His-Arg-Leu-Val-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Ser-Met-Val-Arg-Ser-Asn-Leu-Leu-Pro-Thr-Lys-Met-Gly-Phe-Lys-Val-Phe-Gly-NH2 (Disulfide bridge: Cys2-Cys7) |
| Shortening | SCNTATCMTHRLVGLLSRSGSMVRSNLLPTKMGFKVFG-NH2 (Disulfide bridge: Cys2-Cys7) |
| Formula | C175H294N54O49S5 |
| Molar Mass | 4098.86 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Notoya M, et al., A novel member of the calcitonin gene-related peptide family, calcitonin receptor-stimulating peptide, inhibits the formation and activity of osteoclasts. Eur J Pharmacol. 2007 Apr 10;560(2-3):234-9. |