| Bioactivity | CRAMP (140-173) (mouse) TFA is a ortholog of human LL-37 antimicrobial peptide. CRAMP (140-173) (mouse) TFA inhibits LPS (HY-D1056)-induced responses, and can not colocalized with TLR3 in BEAS-2B cells[1]. |
| Sequence | Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln |
| Shortening | GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ |
| Formula | C178H302N50O46.xC2HF3O2 |
| Molar Mass | 3878.61 (free acid) |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Singh D, et al. The human antimicrobial peptide LL-37, but not the mouse ortholog, mCRAMP, can stimulate signaling by poly(I:C) through a FPRL1-dependent pathway. J Biol Chem. 2013;288(12):8258-8268. |
CRAMP (140-173) (mouse) TFA
CAS: F: C178H302N50O46.xC2HF3O2 W: 3878.61 (free acid)
CRAMP (140-173) (mouse) TFA is a ortholog of human LL-37 antimicrobial peptide. CRAMP (140-173) (mouse) TFA inhibits LPS
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.