| Bioactivity | CNP-38 is a C-type natriuretic peptide[1]. |
| Name | CNP-38 |
| Sequence | Leu-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys (Disulfide bridge: Cys22-Cys38) |
| Shortening | LQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge: Cys22-Cys38) |
| Formula | C175H291N55O50S3 |
| Molar Mass | 4061.72 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Vibeke Miller Breinholt, et al. TransCon CNP, a Sustained-Release C-Type Natriuretic Peptide Prodrug, a Potentially Safe and Efficacious New Therapeutic Modality for the Treatment of Comorbidities Associated with Fibroblast Growth Factor Receptor 3-Related Skeletal Dysplasias. J Pharmacol Exp Ther. 2019 Sep;370(3):459-471. |