| Bioactivity | CART (61-102) (rat), is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of drug research and development[1]. |
| Name | CART (61-102) (rat) |
| CAS | 209615-75-8 |
| Sequence | Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu (Disulfide bridge: Cys68-Cys86,Cys74-Cys94,Cys88-Cys101) |
| Shortening | KYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL (Disulfide bridge: Cys68-Cys86,Cys74-Cys94,Cys88-Cys101) |
| Formula | C189H316N58O56S7 |
| Molar Mass | 4521.34 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Birnbaum S, et al. Peptide screening. Current Opinion in Biotechnology, 1992, 3(1): 49-54. |
CART (61-102) (rat)
CAS: 209615-75-8 F: C189H316N58O56S7 W: 4521.34
CART (61-102) (rat), is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.