| Bioactivity | CART (1-39), Human, Rat is a neuropeptide consisting of 1-39 residues of the CART peptide. CART (1-39), Human, Rat is a rat satiety factor with potent appetite-suppressing activity and is closely associated with leptin and neuropeptide Y. CART (1-39), Human, Rat inhibits both normal and starvation-induced feeding. CART (1-39), Human, Rat can induce anxiety and stress-related behavior[1]. |
| Invitro | CART (1-39), Human, Rat (100 nM) increases intracellular calcium concentrations in rat cortical neurons[1]. |
| Name | CART (1-39), Human, Rat |
| Shortening | {Glp}-EDAELQPRALDIYSAVDDASHEKELPRRQLRAPGAVLQ |
| Formula | C188H303N57O63 |
| Molar Mass | 4369.76 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
CART (1-39), Human, Rat
CAS: F: C188H303N57O63 W: 4369.76
CART (1-39), Human, Rat is a neuropeptide consisting of 1-39 residues of the CART peptide. CART (1-39), Human, Rat is a
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.