| Bioactivity | CAP18 (rabbit) is a 37 amino acids antimicrobial peptide originally isolated from rabbit granulocytes. CAP18 (rabbit) has broad antimicrobial activity against both Gram-positive (IC50, 130-200 nM) and Gram-negative (IC50, 20-100 nM) bacteria. CAP18 (rabbit) has the potential for bacterial sepsis research[1]. |
| Name | CAP18 (rabbit) |
| CAS | 152742-15-9 |
| Shortening | GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY |
| Formula | C202H356N64O47 |
| Molar Mass | 4433.47 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
CAP18 (rabbit)
CAS: 152742-15-9 F: C202H356N64O47 W: 4433.47
CAP18 (rabbit) is a 37 amino acids antimicrobial peptide originally isolated from rabbit granulocytes. CAP18 (rabbit) ha
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.