Bioactivity | C5a Anaphylatoxin (human) is a pro-inflammatory peptide and a leukocyte chemoattractant. C5a Anaphylatoxin (human) can be used to study inflammation and immunity, such as allergic asthma[1][2]. |
Name | C5a Anaphylatoxin (human) |
CAS | 1816940-05-2 |
Sequence | Thr-Leu-Gln-Lys-Lys-Ile-Glu-Glu-Ile-Ala-Ala-Lys-Tyr-Lys-His-Ser-Val-Val-Lys-Lys-Cys-Cys-Tyr-Asp-Gly-Ala-Cys-Val-Asn-Asn-Asp-Glu-Thr-Cys-Glu-Gln-Arg-Ala-Ala-Arg-Ile-Ser-Leu-Gly-Pro-Arg-Cys-Ile-Lys-Ala-Phe-Thr-Glu-Cys-Cys-Val-Val-Ala-Ser-Gln-Leu-Arg-Ala-Asn-Ile-Ser-His-Lys-Asp-Met-Gln-Leu-Gly-Arg (Disulfide bridge: Cys21-Cys47,Cys22-Cys54,Cys34-Cys55) |
Shortening | TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR (Disulfide bridge: Cys21-Cys47,Cys22-Cys54,Cys34-Cys55) |
Formula | C350H578N108O107S8 |
Molar Mass | 8267.51 |
Transport | Room temperature in continental US; may vary elsewhere. |
Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Reference | [1]. Monk PN, et al. Function, structure and therapeutic potential of complement C5a receptors. Br J Pharmacol. 2007 Oct;152(4):429-48. [2]. Köhl J, et al. A regulatory role for the C5a anaphylatoxin in type 2 immunity in asthma. J Clin Invest. 2006 Mar;116(3):783-96. |