| Bioactivity | C-Type Natriuretic Peptide (1-53), human TFA is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide TFA is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone[1]. |
| Name | C-Type Natriuretic Peptide (1-53), human TFA |
| Sequence | Asp-Leu-Arg-Val-Asp-Thr-Lys-Ser-Arg-Ala-Ala-Trp-Ala-Arg-Leu-Leu-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys (Disulfide bridge:Cys37-Cys55) |
| Shortening | DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge:Cys37-Cys55) |
| Formula | C251H417N81O71S3.C2HF3O2 |
| Molar Mass | 5915.79 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Minamino N, et al. N-terminally extended form of C-type natriuretic peptide (CNP-53) identified in porcine brain. Biochem Biophys Res Commun. 1990 Jul 31;170(2):973-9. |
C-Type Natriuretic Peptide (1-53), human TFA
CAS: F: C251H417N81O71S3.C2HF3O2 W: 5915.79
C-Type Natriuretic Peptide (1-53), human TFA is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Pept
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.