Brain Natriuretic Peptide (1-32), rat_product_DataBase

Bioactivity	Brain Natriuretic Peptide (1-32), rat (BNP (1-32), rat) is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes)[1].
Invitro	B-type natriuretic peptide (BNP) combats cardiac stress by reducing blood pressure and ventricular fibrosis. Rat BNP BNP (1-32) (rBNP (1-32)) is an amino-truncated form of the 45 residue natural rat form of BNP[1]. Atrial natriuretic peptide-(1-28) (ANP), brain natriuretic peptide-(1-32) (BNP) and C-Type natriuretic polypeptide (CNP) occur in the brain, are concentrated in the anteroventral area of the third cerebral ventricle and participate in the regulation of body fluid homeostasis. The ANP(1-28), BNP (1-32) and CNP(1-32) function in the mammalian brain to regulate salt and water homeostasis via their receptors NPR-A and NPR-B[2].
Name	Brain Natriuretic Peptide (1-32), rat
CAS	133448-20-1
Sequence	Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe (Disulfide bridge: Cys10-Cys26)
Shortening	NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: Cys10-Cys26)
Formula	C146H239N47O44S3
Molar Mass	3452.94
Transport	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.

PeptideDB