PeptideDB

Bovine neutrophil beta-defensin 12

CAS: 455257-02-0 F: C174H281N57O44S7 W: 4099.90

Bovine neutrophil beta-defensin 12 is an antimicrobial peptide derived from bovine neutrophils, which has antibacterial
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Bovine neutrophil beta-defensin 12 is an antimicrobial peptide derived from bovine neutrophils, which has antibacterial activity against Escherichia coli and Staphylococcus aureus[1].
Name Bovine neutrophil beta-defensin 12
CAS 455257-02-0
Sequence Gly-Pro-Leu-Ser-Cys-Gly-Arg-Asn-Gly-Gly-Val-Cys-Ile-Pro-Ile-Arg-Cys-Pro-Val-Pro-Met-Arg-Gln-Ile-Gly-Thr-Cys-Phe-Gly-Arg-Pro-Val-Lys-Cys-Cys-Arg-Ser-Trp (Disulfide bridge:Cys5-Cys34;Cys12-Cys27;Cys17-Cys35)
Shortening GPLSCGRNGGVCIPIRCPVPMRQIGTCFGRPVKCCRSW (Disulfide bridge:Cys5-Cys34;Cys12-Cys27;Cys17-Cys35)
Formula C174H281N57O44S7
Molar Mass 4099.90
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Zimmermann GR, et al. Solution structure of bovine neutrophil beta-defensin-12: the peptide fold of the beta-defensins is identical to that of the classical defensins. Biochemistry. 1995 Oct 17;34(41):13663-71.