| Bioactivity | BmK-M1 is a scorpion toxin, and is composed of 64 amino acids cross-linked by four disulfide bridges. BmK-M1 inhibits Na+ channel and can be considered both as a cardiotoxin and a neurotoxin[1]. |
| Name | BmK-M1 |
| Sequence | Val-Arg-Asp-Ala-Tyr-Ile-Ala-Lys-Pro-His-Asn-Cys-Val-Tyr-Glu-Cys-Ala-Arg-Asn-Glu-Tyr-Cys-Asn-Asp-Leu-Cys-Thr-Lys-Asn-Gly-Ala-Lys-Ser-Gly-Tyr-Cys-Gln-Trp-Val-Gly-Lys-Tyr-Gly-Asn-Gly-Cys-Trp-Cys-Ile-Glu-Leu-Pro-Asp-Asn-Val-Pro-Ile-Arg-Val-Pro-Gly-Lys-Cys-His (Disulfide bridge:Cys12-Cys63;Cys16-Cys36;Cys22-Cys46;Cys26-Cys48) |
| Shortening | VRDAYIAKPHNCVYECARNEYCNDLCTKNGAKSGYCQWVGKYGNGCWCIELPDNVPIRVPGKCH (Disulfide bridge:Cys12-Cys63;Cys16-Cys36;Cys22-Cys46;Cys26-Cys48) |
| Formula | C313H467N91O91S8 |
| Molar Mass | 7217.13 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. C Goudet, et al. Electrophysiological characterization of BmK M1, an alpha-like toxin from Buthus martensi Karsch venom. FEBS Lett. 2001 Apr 20;495(1-2):61-5. |