PeptideDB

Biotinyl-LL-37

CAS: 2243219-80-7 F: C215H354N62O55S W: 4719.56

Biotinyl-LL-37, is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Biotinyl-LL-37, is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of drug research and development[1].
Name Biotinyl-LL-37
CAS 2243219-80-7
Sequence {Biotinyl-Leu}-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser
Shortening {Biotinyl-Leu}-LGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Formula C215H354N62O55S
Molar Mass 4719.56
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Birnbaum S, et al. Peptide screening. Current Opinion in Biotechnology, 1992, 3(1): 49-54.