| Bioactivity | Biotinyl-Ahx-Amyloid β-Protein (1-42) ammonium is a N-terminally biotin-labeled Amyloid β-Protein (1-42). Amyloid β-protein is the primary component of both vascular and parenchymal amyloid deposits in Alzheimer's disease[1]. |
| Name | Biotinyl-Ahx-Amyloid β-Protein (1-42) (ammonium) |
| Shortening | {Biotinyl-Ahx}-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAA (ammonium) |
| Formula | C219H339N59O63S2 |
| Molar Mass | 4870.52 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Biotinyl-Ahx-Amyloid β-Protein (1-42) (ammonium)
CAS: F: C219H339N59O63S2 W: 4870.52
Biotinyl-Ahx-Amyloid β-Protein (1-42) ammonium is a N-terminally biotin-labeled Amyloid β-Protein (1-42). Amyloid β-p
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.