| Bioactivity | Biotinyl-ACTH (1-39) (human) is abiotinylated Adrenocorticotropic Hormone (ACTH) (1-39), human (HY-P1211). |
| Name | Biotinyl-ACTH (1-39) (human) |
| CAS | 1816258-26-0 |
| Sequence | Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe |
| Shortening | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
| Formula | C207H308N56O58S |
| Molar Mass | 4541.07 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Biotinyl-ACTH (1-39) (human)
CAS: 1816258-26-0 F: C207H308N56O58S W: 4541.07
Biotinyl-ACTH (1-39) (human) is abiotinylated Adrenocorticotropic Hormone (ACTH) (1-39), human (HY-P1211).
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.